PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN45505.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 385aa    MW: 41961.7 Da    PI: 4.6951
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN45505.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.8e-39121180261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG +rnvPvG+grrknk+ 
  KHN45505.1 121 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGVMRNVPVGAGRRKNKNF 180
                 7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30111178IPR003851Zinc finger, Dof-type
PfamPF027016.7E-32123179IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.901125179IPR003851Zinc finger, Dof-type
PROSITE patternPS013610127163IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MLESKDSTMK LFGKTIPAPE ISAGAPALSS GDADAVGVVQ NHGSSSVNGD GEEHEIEQDI  60
MGEETTESEK EDEVTNLDTV SRPGEVSINP STKKEDLTLK TSKKTEQEQG ENSQDKTLRK  120
PDKILPCPRC NSMDTKFCYY NNYNVNQPRH FCKNCQRYWT AGGVMRNVPV GAGRRKNKNF  180
TSQYRQITVP EAALLSSQPD LPNGVSHPSL NCNATLLAFG SDTPLCESMT SVLNLAEKAV  240
NNSTTNGFNG SEELEIPFAY VAGEKVNDDS NKSSDMSTKP MEGETTNRSQ EQVIENCHPF  300
PPHAPYFPGA PWPFPWNPAL WNSPVPSPPA FFPQGFTMPL YPAAAYWGLT IPGAWSIPWL  360
AQPSLPNSTV SNSGPDPIAR TIAMS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311470.0KT031147.1 Glycine max clone HN_CCL_144 C2C2-Zn Dof transcription factor (Glyma19g02710.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014626858.10.0PREDICTED: dof27 isoform X1
TrEMBLA0A0B2SKC40.0A0A0B2SKC4_GLYSO; Dof zinc finger protein DOF5.2
TrEMBLI1N6540.0I1N654_SOYBN; C2C2-Zn Dof transcription factor
STRINGGLYMA19G02710.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3665322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-62cycling DOF factor 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]